PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 255aa    MW: 28957.5 Da    PI: 8.5828
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1265genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.9e-131361148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l++++++ G   +W+t +r  g+ R +k+c++rw +yl
      Gh_A01G1265 13 KGTWSKQEDEKLLNYIRKNGEAgCWRTLPRAAGLLRGGKSCRLRWINYL 61
                     799*****************989**********99************97 PP

2Myb_DNA-binding52.41.3e-1668112248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g++ ++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A01G1265  68 GNFGEDEDDLIIKLHTLLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 112
                      6899*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.535861IPR017930Myb domain
SuperFamilySSF466897.76E-2511108IPR009057Homeodomain-like
SMARTSM007174.3E-101263IPR001005SANT/Myb domain
PfamPF002496.1E-111361IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-171468IPR009057Homeodomain-like
CDDcd001673.70E-71561No hitNo description
PROSITE profilePS5129424.93262116IPR017930Myb domain
SMARTSM007171.8E-1466114IPR001005SANT/Myb domain
PfamPF002492.2E-1468112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2469117IPR009057Homeodomain-like
CDDcd001676.84E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MRKPCCDKRD TNKGTWSKQE DEKLLNYIRK NGEAGCWRTL PRAAGLLRGG KSCRLRWINY  60
LRPDVKIGNF GEDEDDLIIK LHTLLGNRWS LIAGRLPGRT DNEVKNYWNS HLRRKLINMG  120
IDPNKHSLTR HNRPHHNSNT NTSASATLIS SASKLPKSHK CIAPPNNKPW RDNDQVSDAA  180
SCLLEDEDDD NLPCSTTQYQ LPDLNLELTI SVSAPNSTAK LEQHDHQIQE PNHKQCSNIS  240
SDLHFSSTPT LLLFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251011624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467309.11e-178PREDICTED: myb-related protein 308-like
SwissprotQ9SZP13e-77MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0D2NPJ81e-178A0A0D2NPJ8_G
STRINGVIT_01s0011g04760.t015e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2506234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.18e-76myb domain protein 4